PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g052530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 310aa    MW: 34694.3 Da    PI: 4.5121
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g052530.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-1863116356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Csa07g052530.1  63 KKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 116
                     5568999**********************************************9 PP

2HD-ZIP_I/II128.13.8e-4162154193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlEkdy +Lk++yd+l+ + ++L++++e+L +e+++
  Csa07g052530.1  62 EKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKNQYDSLRLNFDSLRRDNESLLQEISK 154
                     69*************************************************************************************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.0758118IPR001356Homeobox domain
SuperFamilySSF466891.42E-1859120IPR009057Homeodomain-like
SMARTSM003893.4E-1761122IPR001356Homeobox domain
CDDcd000862.23E-1563119No hitNo description
PfamPF000461.4E-1563116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-1965125IPR009057Homeodomain-like
PRINTSPR000318.6E-68998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000318.6E-698114IPR000047Helix-turn-helix motif
PfamPF021832.7E-16118159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MMKRLSSSDS VGGLISLCPT TSTDEQSPRR YGGREFQSML LEGYEEEEEA IVEERGHVGM  60
SEKKRRLSIN QVKALEKNFE LENKLEPERK VKLAQELGLQ PRQVAVWFQN RRARWKTKQL  120
EKDYGVLKNQ YDSLRLNFDS LRRDNESLLQ EISKLKTKLN GGGEEEENNA AAATTDSDVS  180
VKEEEVSLPE KITELPSSPP QFLEHSDGLN YRSFTDLRDL LPLKGAASSF AAAGSSDSSD  240
SSALLNEESS SNVTVAAPVA APSGNFFQFV KMEQTEDHGD FLSGEEACEF FSDEQPPSLH  300
WYSTVDHWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110118RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00271DAPTransfer from AT2G22430Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0605690.0AY060569.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankAY0638190.0AY063819.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-6 (At2g22430) mRNA, complete cds.
GenBankAY0944570.0AY094457.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankAY1229030.0AY122903.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBankX670340.0X67034.1 A.thaliana mRNA Athb-6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417002.10.0PREDICTED: homeobox-leucine zipper protein ATHB-6-like
SwissprotP466680.0ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBLD7LE051e-178D7LE05_ARALL; Putative uncharacterized protein
STRINGAT2G22430.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.11e-154homeobox protein 6